Eya2 Peptide - middle region
Eya2 Peptide - middle region
Product Specifications
UniProt
Q6UN47
Field of Research
Epigenetics & Chromatin
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Eya2 Rabbit Polyclonal Antibody (orb574202) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_569111
Preservative
Lyophilized powder
AA Sequence
EAPHNVSQSSESLAGDYNTHNGPSTPAKEGDTDRPHRASDGKLRGRSKRS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
PTX23821 100 µg
Anti-Human CD134/TNFRSF4/OX40 Monoclonal Antibody (ABS2105), PE
Sign In for Pricing
View Details 
M08644-3-carrier-free 100 µL
Anti-CRMP5 Rabbit Monoclonal Antibody, Carrier-free
Sign In for Pricing
View Details 
383263 96 Tests
HMGCR (3-Hydroxy-3-methylglutaryl CoA Reductase) BioAssayTM ELISA Kit (Human) discontinued
Sign In for Pricing
View Details