Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Eya2 Peptide - middle region

Eya2 Peptide - middle region

Product Specifications

UniProt

Q6UN47

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Eya2 Rabbit Polyclonal Antibody (orb574202) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_569111

Preservative

Lyophilized powder

AA Sequence

EAPHNVSQSSESLAGDYNTHNGPSTPAKEGDTDRPHRASDGKLRGRSKRS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-KCTD1
Y158072 100 µL

Anti-KCTD1

Sign In for Pricing
View Details
Anti-RGS3 antibody
MBS176390-01 0.01 mg

Anti-RGS3 antibody

Sign In for Pricing
View Details
Anti-RGS3 antibody
MBS176390-02 0.1 mg (Carrier Free)

Anti-RGS3 antibody

Sign In for Pricing
View Details
Anti-RGS3 antibody
MBS176390-03 0.1 mg

Anti-RGS3 antibody

Sign In for Pricing
View Details
Anti-RGS3 antibody
MBS176390-04 0.1 mg (Cy3)

Anti-RGS3 antibody

Sign In for Pricing
View Details
Anti-RGS3 antibody
MBS176390-05 0.1 mg (Biotin)

Anti-RGS3 antibody

Sign In for Pricing
View Details