Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

F7 Peptide - middle region

F7 Peptide - middle region

Product Specifications

Product Name Alternative

SPCA

UniProt

P08709

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with F7 Rabbit Polyclonal Antibody (orb584554) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000122

Preservative

Lyophilized powder

AA Sequence

RCHEGYSLLADGVSCTPTVEYPCGKIPILEKRNASKPQGRIVGGKVCPKG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4- (Furan-2-yl) -4-oxobutanenitrile
SAA96037-01 50 mg

4- (Furan-2-yl) -4-oxobutanenitrile

Sign In for Pricing
View Details
4- (Furan-2-yl) -4-oxobutanenitrile
SAA96037-02 0.5 g

4- (Furan-2-yl) -4-oxobutanenitrile

Sign In for Pricing
View Details
SQSTM1 Antibody - C-terminal region
MBS3219607-01 0.1 mL

SQSTM1 Antibody - C-terminal region

Sign In for Pricing
View Details
SQSTM1 Antibody - C-terminal region
MBS3219607-02 5x 0.1 mL

SQSTM1 Antibody - C-terminal region

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana GDSL esterase/lipase At2g19050 (At2g19050)
MBS1252766-01 0.02 mg (E-Coli)

Recombinant Arabidopsis thaliana GDSL esterase/lipase At2g19050 (At2g19050)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana GDSL esterase/lipase At2g19050 (At2g19050)
MBS1252766-02 0.02 mg (Yeast)

Recombinant Arabidopsis thaliana GDSL esterase/lipase At2g19050 (At2g19050)

Sign In for Pricing
View Details