Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fa2h Peptide - C-terminal region

Fa2h Peptide - C-terminal region

Product Specifications

Product Name Alternative

FAAH, Faxdc1, G630055L08Rik

UniProt

Q5MPP0

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Fa2h Rabbit Polyclonal Antibody (orb574523) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_835187

Preservative

Lyophilized powder

AA Sequence

HGQHHKAPFDGSRLVFPPVPASLVIAFFYVFLRLILPETVGGIIFAGGLL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Apolipoprotein E (APOE) Mouse Monoclonal Antibody [Clone ID: OTI1E6]
CF805091 100 µg

Apolipoprotein E (APOE) Mouse Monoclonal Antibody [Clone ID: OTI1E6]

Sign In for Pricing
View Details
Caffeine-D10
TRC-C122030-5MG 5 mg

Caffeine-D10

Sign In for Pricing
View Details
CD103 / Integrin alpha E (T-Cell Lymphoma & Hairy Cell Leukemia Marker) (ITGAE/2063), 1mg/mL
BNUM2063-50 1x 50 µL

CD103 / Integrin alpha E (T-Cell Lymphoma & Hairy Cell Leukemia Marker) (ITGAE/2063), 1mg/mL

Sign In for Pricing
View Details
Calponin-1 (CALP), CF647 conjugate, 0.1mg/mL
BNC470831-100 1x 100 µL

Calponin-1 (CALP), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS708588 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Rat CD90/Mouse CD90.1 Antibody[OX-7]
E-AB-F1226H-01 50 Tests

PE/Cyanine7 Anti-Rat CD90/Mouse CD90.1 Antibody[OX-7]

Sign In for Pricing
View Details