Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fa2h Peptide - C-terminal region

Fa2h Peptide - C-terminal region

Product Specifications

Product Name Alternative

FAAH, Faxdc1, G630055L08Rik

UniProt

Q5MPP0

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Fa2h Rabbit Polyclonal Antibody (orb574523) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_835187

Preservative

Lyophilized powder

AA Sequence

HGQHHKAPFDGSRLVFPPVPASLVIAFFYVFLRLILPETVGGIIFAGGLL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BACH2 (Center) Rabbit Polyclonal Antibody
AP50334PU-N 400 µL

BACH2 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human IgD (Immunoglobulin Delta Heavy Chain) (B-Cell Marker) (IgD26), CF405S conjugate, 0.1mg/mL
BNC042097-500 1x 500 µL

Human IgD (Immunoglobulin Delta Heavy Chain) (B-Cell Marker) (IgD26), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
8-Hydroxyquinoline
TRC-H953265-1G 1 g

8-Hydroxyquinoline

Sign In for Pricing
View Details
Human ATP11C activation kit by CRISPRa
GA117297 1 Kit

Human ATP11C activation kit by CRISPRa

Sign In for Pricing
View Details
(R)-N-(1-Carboxyethyl)-D-norvaline 1-Ethyl Ester
TRC-C178075-25MG 25 mg

(R)-N-(1-Carboxyethyl)-D-norvaline 1-Ethyl Ester

Sign In for Pricing
View Details
BMP6 (N-term) Rabbit Polyclonal Antibody
AP11667PU-N 400 µL

BMP6 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details