Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OTULINL Peptide - N-terminal region

OTULINL Peptide - N-terminal region

Product Specifications

Product Name Alternative

NET20, FAM105A

UniProt

Q9NUU6

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OTULINL Rabbit Polyclonal Antibody (orb580727) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_061891

Preservative

Lyophilized powder

AA Sequence

HKLKWWIGYLQRKFKRNLSVEAEVDLLSYCAREWKGETPRNKLMRKAYEE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GCM1 Mouse Monoclonal Antibody [Clone ID: OTI5F9]
CF810521 100 µg

GCM1 Mouse Monoclonal Antibody [Clone ID: OTI5F9]

Sign In for Pricing
View Details
IP1 Maleimide
20341-AAT 100 µg

IP1 Maleimide

Sign In for Pricing
View Details
FAM38A / PIEZO1 Recombinant Mouse monoclonal Antibody
HA610024 100 µg

FAM38A / PIEZO1 Recombinant Mouse monoclonal Antibody

Sign In for Pricing
View Details
Neurofibromin (NF1) (NM_001128147) Human Over-expression Lysate
LY426897 100 µg

Neurofibromin (NF1) (NM_001128147) Human Over-expression Lysate

Sign In for Pricing
View Details
ECI2 Antibody
KC-563-01 50 μL

ECI2 Antibody

Sign In for Pricing
View Details
ECI2 Antibody
KC-563-02 100 µL

ECI2 Antibody

Sign In for Pricing
View Details