Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OTULINL Peptide - N-terminal region

OTULINL Peptide - N-terminal region

Product Specifications

Product Name Alternative

NET20, FAM105A

UniProt

Q9NUU6

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OTULINL Rabbit Polyclonal Antibody (orb580727) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_061891

Preservative

Lyophilized powder

AA Sequence

HKLKWWIGYLQRKFKRNLSVEAEVDLLSYCAREWKGETPRNKLMRKAYEE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

L-Tryptophan-d5
TRC-T947212-2.5MG 2.5 mg

L-Tryptophan-d5

Sign In for Pricing
View Details
4'-Bromovalerophenone
TRC-B689025-1G 1 g

4'-Bromovalerophenone

Sign In for Pricing
View Details
TIM 3 (HAVCR2) Rabbit Polyclonal Antibody
TA372322 100 µL

TIM 3 (HAVCR2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
DR5 (TNFRSF10B) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5G5]
TA807290AM 100 µL

DR5 (TNFRSF10B) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5G5]

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS501716 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Human CD35 Antibody[E11]
E-AB-F1062H-01 20 Tests

PE/Cyanine7 Anti-Human CD35 Antibody[E11]

Sign In for Pricing
View Details