Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PHETA1 Peptide - N-terminal region

PHETA1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

SES1, FAM109A, IPIP27A

UniProt

Q8N4B1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PHETA1 Rabbit Polyclonal Antibody (orb581813) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_653272

Preservative

Lyophilized powder

AA Sequence

HRRWFVLRGNMLFYFEDAASREPVGVIILEGCTVELVEAAEEFAFAVRFA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ANG-R-Tie1 (Angiopoietin Receptor Tie1) CLIA Kit
E-CL-H0272-01 24 Tests

Human ANG-R-Tie1 (Angiopoietin Receptor Tie1) CLIA Kit

Sign In for Pricing
View Details
Human ANG-R-Tie1 (Angiopoietin Receptor Tie1) CLIA Kit
E-CL-H0272-02 48 Tests

Human ANG-R-Tie1 (Angiopoietin Receptor Tie1) CLIA Kit

Sign In for Pricing
View Details
Human ANG-R-Tie1 (Angiopoietin Receptor Tie1) CLIA Kit
E-CL-H0272-03 96 Tests

Human ANG-R-Tie1 (Angiopoietin Receptor Tie1) CLIA Kit

Sign In for Pricing
View Details
Recombinant CD3G Antibody
RC-4654-01 50 μL

Recombinant CD3G Antibody

Sign In for Pricing
View Details
Recombinant CD3G Antibody
RC-4654-02 100 µL

Recombinant CD3G Antibody

Sign In for Pricing
View Details
Recombinant CD3G Antibody
RC-4654-03 1 mL

Recombinant CD3G Antibody

Sign In for Pricing
View Details