FAM29A Peptide - middle region
FAM29A Peptide - middle region
Product Specifications
Product Name Alternative
Dgt6, FAM29A, MGC102696, MGC138798, MGC138799, RP11-296P7.3
UniProt
Q7Z4H7
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with FAM29A Rabbit Polyclonal Antibody (orb583403) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_060115
Preservative
Lyophilized powder
AA Sequence
DFNLQALRSRYEALKKSLSKKREESYLSNSQTPERHKPELSPTPQNVQTD
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC400225-100 1x 100 µL
Major Vault Protein (MVP) (1032), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470225-100 1x 100 µL
Major Vault Protein (MVP) (1032), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC941429-100 1x 100 µL
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400026-100 1x 100 µL
ACTH (Adrenocorticotrophic Hormone) (AH26), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
