Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SHLD2 Peptide - N-terminal region

SHLD2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

RINN2, FAM35A, FAM35A1, bA163M19.1

UniProt

Q86V20

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SHLD2 Rabbit Polyclonal Antibody (orb583524) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_061927

Preservative

Lyophilized powder

AA Sequence

PDLSGHFLANCMNRHVHVKDDFVRSVSETQNIESQKIHSSRLSDITSSNM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PLV3-U6-CACNA1C-sgRNA1-Cas9-EGFP-Puro Plasmid
PVT82707 2 µg

PLV3-U6-CACNA1C-sgRNA1-Cas9-EGFP-Puro Plasmid

Sign In for Pricing
View Details
HOXD11 (Homeobox D11, Hox-4.6, mouse, Homolog of, Homeo box 4F, Homeo box D11, Homeobox Protein Hox-D11, HOX4, HOX4F) (PE)
207711-PE 100 µL

HOXD11 (Homeobox D11, Hox-4.6, mouse, Homolog of, Homeo box 4F, Homeo box D11, Homeobox Protein Hox-D11, HOX4, HOX4F) (PE)

Sign In for Pricing
View Details
Duck Melanoma-Associated Antigen C3 (MAGEC3) ELISA Kit
MBS9353844 Inquire

Duck Melanoma-Associated Antigen C3 (MAGEC3) ELISA Kit

Sign In for Pricing
View Details
AGS-Cas9 Cell Line
RG-019 1x 10^6

AGS-Cas9 Cell Line

Sign In for Pricing
View Details
LOXL4 CRISPR Knock Out 293T Cell Line (Human)
27545141 1x 10^6 Cells / 1.0 mL

LOXL4 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
Human IL-1R2 ELISA Kit
E019410 1 Each

Human IL-1R2 ELISA Kit

Sign In for Pricing
View Details