Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SHLD2 Peptide - N-terminal region

SHLD2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

RINN2, FAM35A, FAM35A1, bA163M19.1

UniProt

Q86V20

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SHLD2 Rabbit Polyclonal Antibody (orb583524) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_061927

Preservative

Lyophilized powder

AA Sequence

PDLSGHFLANCMNRHVHVKDDFVRSVSETQNIESQKIHSSRLSDITSSNM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SCN4B Protein Vector (Mouse) (pPM-C-HA)
PV227068 500 ng

SCN4B Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Lentiviral human GGPS1 shRNA (UAS) - Lentiviral human GGPS1 shRNA (UAS, iRFP) (100)
GTR15340962 1 Vial

Lentiviral human GGPS1 shRNA (UAS) - Lentiviral human GGPS1 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
Recombinant Mycobacterium Abscessus rplT Protein (aa 1-129)
VAng-Yyj5555-500gEcoli 500 µg (E. coli)

Recombinant Mycobacterium Abscessus rplT Protein (aa 1-129)

Sign In for Pricing
View Details
Canine Brain natriuretic peptide,BNP ELISA KIT
JOT-EK0029Ca-01 96 Well

Canine Brain natriuretic peptide,BNP ELISA KIT

Sign In for Pricing
View Details
Canine Brain natriuretic peptide,BNP ELISA KIT
JOT-EK0029Ca-02 48 Well

Canine Brain natriuretic peptide,BNP ELISA KIT

Sign In for Pricing
View Details
PHKG1 Polyclonal Antibody, APC Conjugated
bs-5009R-APC 100 µL

PHKG1 Polyclonal Antibody, APC Conjugated

Sign In for Pricing
View Details