Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FAM3D Peptide - middle region

FAM3D Peptide - middle region

Product Specifications

Product Name Alternative

EF7, OIT1

UniProt

Q96BQ1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FAM3D Rabbit Polyclonal Antibody (orb581791) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_620160

Preservative

Lyophilized powder

AA Sequence

LVASYDDPGTKMNDESRKLFSDLGSSYAKQLGFRDSWVFIGAKDLRGKSP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PAN2 Human Gene Knockout Kit (CRISPR)
KN400573 1 Kit

PAN2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
DBNDD2 (NM_001048221) Human Over-expression Lysate
LC420786 20 µg

DBNDD2 (NM_001048221) Human Over-expression Lysate

Sign In for Pricing
View Details
OC-3 Rabbit Polyclonal Antibody
HA500470 100 µL

OC-3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human STK36 activation kit by CRISPRa
GA109037 1 Kit

Human STK36 activation kit by CRISPRa

Sign In for Pricing
View Details
Human DUOXA2 activation kit by CRISPRa
GA118394 1 Kit

Human DUOXA2 activation kit by CRISPRa

Sign In for Pricing
View Details
Biotin Conjugated Sophora japonica (Pagoda Tree) -SJA-
BA-2901-1 1 mg

Biotin Conjugated Sophora japonica (Pagoda Tree) -SJA-

Sign In for Pricing
View Details