Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FAM3D Peptide - middle region

FAM3D Peptide - middle region

Product Specifications

Product Name Alternative

EF7, OIT1

UniProt

Q96BQ1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FAM3D Rabbit Polyclonal Antibody (orb581791) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_620160

Preservative

Lyophilized powder

AA Sequence

LVASYDDPGTKMNDESRKLFSDLGSSYAKQLGFRDSWVFIGAKDLRGKSP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Colon
CS517462 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details
(2-ethoxyethyl)hydrazine xHCl salt
TRC-E677283-500MG 500 mg

(2-ethoxyethyl)hydrazine xHCl salt

Sign In for Pricing
View Details
Vmn1r77 Mouse Gene Knockout Kit (CRISPR)
KN519093 1 Kit

Vmn1r77 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Sodium Cyanoborodeuteride
TRC-S615502-1G 1 g

Sodium Cyanoborodeuteride

Sign In for Pricing
View Details
TNFSF12-TNFSF13 Rabbit Polyclonal Antibody
AP20513PU-N 100 µg

TNFSF12-TNFSF13 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
N,N-Diethyl-N’-1-naphthylethylenediamine Oxalate
TRC-D443735-1G 1 g

N,N-Diethyl-N’-1-naphthylethylenediamine Oxalate

Sign In for Pricing
View Details