FAM45BP Peptide - middle region
FAM45BP Peptide - middle region
Product Specifications
Product Name Alternative
HT011, FAM45B
UniProt
Q6NSW5
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with FAM45BP Rabbit Polyclonal Antibody (orb326174) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_060942
Preservative
Lyophilized powder
AA Sequence
AEDPEKSESQVIQDIALKTREIFTNLAPFSEVSADGEKRVLNLEALKQKR
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC040218-100 1x 100 µL
CD100 (Semaphorin-4D) (A8), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470181-100 1x 100 µL
CD59 (heavy chain of Protectin) (BRA-10G), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC472205-100 1x 100 µL
PGP9.5 / UchL1 (pan-Neuronal Marker) (rUCHL1/775), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details