FAM71A Peptide - C-terminal region
FAM71A Peptide - C-terminal region
Product Specifications
Product Name Alternative
FLJ32796, RP11-338C15.4
UniProt
Q8IYT1
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Tested Applications
WB
NCBI Accession Number
NP_705834
Preservative
Lyophilized powder
AA Sequence
PGSSRHRDSHKGVSHTPISKESRTSHKSGRSLWTTSSGSSKGLGRVSSFL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC050391-100 1x 100 µL
CD81 / TAPA-1 (1.3.3.22), CF405M conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740745-500 1x 500 µL
CD45 / LCA (2B11 + PD7/26), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400158-100 1x 100 µL
Cytokeratin 17 (E3), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040253-100 1x 100 µL
Cytokeratin, LMW (AE-1), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC472276-100 1x 100 µL
CD52 (Epididymis-Specific Protein 5) (CD52/2276R), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC401171-100 1x 100 µL
CD34 (HPCA1/1171), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details