Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FAM78A Peptide - C-terminal region

FAM78A Peptide - C-terminal region

Product Specifications

Product Name Alternative

C9orf59, FLJ00024, RP11-544A12.6

UniProt

Q5JUQ0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FAM78A Rabbit Polyclonal Antibody (orb582748) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_203745

Preservative

Lyophilized powder

AA Sequence

WRMQLSIEVNPNRPLGQRARLREPIAQDQPKILSKNEPIPPSALVKPNAN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dctn1 AAV siRNA Pooled Vector
17750166 1.0 µg

Dctn1 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
HINT1 Human siRNA Oligo Duplex (Locus ID 3094)
SR302105 1 Kit

HINT1 Human siRNA Oligo Duplex (Locus ID 3094)

Sign In for Pricing
View Details
GRK 7 Double Nickase Plasmid (h)
sc-407868-NIC 20 µg

GRK 7 Double Nickase Plasmid (h)

Sign In for Pricing
View Details
MYCP sgRNA CRISPR Lentivector (Human) (Target 2)
K1372803 1.0 µg DNA

MYCP sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
LRRC58 Protein Vector (Mouse) (pPB-C-His)
PV197778 500 ng

LRRC58 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
IKK-alpha/beta (Phospho-Ser176/177) Polyclonal Conjugated Antibody
MBS9437382-01 0.1 mL (Biotin)

IKK-alpha/beta (Phospho-Ser176/177) Polyclonal Conjugated Antibody

Sign In for Pricing
View Details