Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FAM78A Peptide - C-terminal region

FAM78A Peptide - C-terminal region

Product Specifications

Product Name Alternative

C9orf59, FLJ00024, RP11-544A12.6

UniProt

Q5JUQ0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FAM78A Rabbit Polyclonal Antibody (orb582748) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_203745

Preservative

Lyophilized powder

AA Sequence

WRMQLSIEVNPNRPLGQRARLREPIAQDQPKILSKNEPIPPSALVKPNAN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC25A33 Antibody
OACA06170-50UG 50 µg

SLC25A33 Antibody

Sign In for Pricing
View Details
PELI1 Antibody Blocking Peptide
orb1513980 500 µg

PELI1 Antibody Blocking Peptide

Sign In for Pricing
View Details
Human SOX9/Transcription factor SOX-9 ELISA Kit
E2370Hu 96 Tests

Human SOX9/Transcription factor SOX-9 ELISA Kit

Sign In for Pricing
View Details
SLC17A5 Protein Lysate (Human) with C-Ha Tag
43910031 100 µg

SLC17A5 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
Human Low Density Lipoprotein (LDL) ELISA Kit
abx252695 96 Well

Human Low Density Lipoprotein (LDL) ELISA Kit

Sign In for Pricing
View Details
DUOX2 Human Gene Knockout Kit (CRISPR)
KN419006 1 Kit

DUOX2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details