Fank1 Peptide - middle region
Fank1 Peptide - middle region
Product Specifications
Product Name Alternative
1700007B22Rik, AI850911
UniProt
Q9DAM9
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Fank1 Rabbit Polyclonal Antibody (orb581324) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_080126
Preservative
Lyophilized powder
AA Sequence
LLLRILEGGHVMIDVPNKFGFTALMVAAQKGYTRLVKILVSNGTDVNLKN
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
033707-PE 200 µL
CDKN2A, NT (S8) (CDKN2A, CDKN2, MTS1, Cyclin-dependent kinase inhibitor 2A, isoforms 1/2/3, Cyclin-dependent kinase 4 inhibitor A, Multiple tumor suppressor 1, p16-INK4a) (PE) discontinued
Sign In for Pricing
View Details 9-80231 1x 100 mL
Rat Cervix Tissue Preparation Buffer 1: Normal Cervical Epithelial Cells
Sign In for Pricing
View Details K7503805 3x 1.0 µg
Pdcd10 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
Sign In for Pricing
View Details