Fank1 Peptide - middle region
Fank1 Peptide - middle region
Product Specifications
Product Name Alternative
1700007B22Rik, AI850911
UniProt
Q9DAM9
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Fank1 Rabbit Polyclonal Antibody (orb581324) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_080126
Preservative
Lyophilized powder
AA Sequence
LLLRILEGGHVMIDVPNKFGFTALMVAAQKGYTRLVKILVSNGTDVNLKN
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
E45H08061-2 20 µg
Neurofilament (NEFL) (NM_006158) Human Over-expression Lysate
Sign In for Pricing
View Details 
MBS6123879-01 0.1 mL
Bcl-X (Apoptosis Regulator Bcl-X, B cell lymphoma 2 like, BCL XL/S, Bcl-2-like Protein 1, Bcl2-L-1, BCL2L, Bcl2l1, BCLX, BclXL, BclXs, Protein phosphatase 1 Regulatory subunit 52, PPP1R52) (PE)
Sign In for Pricing
View Details MBS6123879-02 5x 0.1 mL
Bcl-X (Apoptosis Regulator Bcl-X, B cell lymphoma 2 like, BCL XL/S, Bcl-2-like Protein 1, Bcl2-L-1, BCL2L, Bcl2l1, BCLX, BclXL, BclXs, Protein phosphatase 1 Regulatory subunit 52, PPP1R52) (PE)
Sign In for Pricing
View Details