Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fank1 Peptide - middle region

Fank1 Peptide - middle region

Product Specifications

Product Name Alternative

1700007B22Rik, AI850911

UniProt

Q9DAM9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Fank1 Rabbit Polyclonal Antibody (orb581324) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_080126

Preservative

Lyophilized powder

AA Sequence

LLLRILEGGHVMIDVPNKFGFTALMVAAQKGYTRLVKILVSNGTDVNLKN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PE Anti-Mouse CD64 Antibody
JOT22043F 25μg

PE Anti-Mouse CD64 Antibody

Sign In for Pricing
View Details
Ctnna1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K7538706 1.0 µg DNA

Ctnna1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
Hsa-miR-4517 miRNA Antagomir
orb1914966-01 10 nmol

Hsa-miR-4517 miRNA Antagomir

Sign In for Pricing
View Details
Hsa-miR-4517 miRNA Antagomir
orb1914966-02 20 nmol

Hsa-miR-4517 miRNA Antagomir

Sign In for Pricing
View Details
E2f7 Rat Pre-designed siRNA Set A
HY-RS25416 1 Set

E2f7 Rat Pre-designed siRNA Set A

Sign In for Pricing
View Details
FITC Anti-Mouse CD19 (1D3)
FITC-30015-01 50 Tests

FITC Anti-Mouse CD19 (1D3)

Sign In for Pricing
View Details