FASTKD2 Peptide - middle region
FASTKD2 Peptide - middle region
Product Specifications
Product Name Alternative
KIAA0971
UniProt
Q9NYY8
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with FASTKD2 Rabbit Polyclonal Antibody (orb582638) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_055744
Preservative
Lyophilized powder
AA Sequence
DTNRNQVLPLSDVDTTSATDIQRVAVLCVSRSAYCLGSSHPRGFLAMKMR
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6473097-01 0.1 mL
Ductin (Vha16, EP2372, V-ATPase, VHA, Vha1, vha16, vha16-1, VHA16K, Vhac) (MaxLight 750)
Sign In for Pricing
View Details MBS6473097-02 5x 0.1 mL
Ductin (Vha16, EP2372, V-ATPase, VHA, Vha1, vha16, vha16-1, VHA16K, Vhac) (MaxLight 750)
Sign In for Pricing
View Details 
MBS6456231-01 0.2 mL
GABRA3 (Gamma-aminobutyric Acid Receptor Subunit alpha-3, GABA(A) Receptor Subunit alpha-3, GABRA3) (FITC)
Sign In for Pricing
View Details MBS6456231-02 5x 0.2 mL
GABRA3 (Gamma-aminobutyric Acid Receptor Subunit alpha-3, GABA(A) Receptor Subunit alpha-3, GABRA3) (FITC)
Sign In for Pricing
View Details