Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FBXL12 Peptide - C-terminal region

FBXL12 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ20188, Fbl12

UniProt

Q9NXK8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_060173

Preservative

Lyophilized powder

AA Sequence

PTEILSSCLTMPKLRVLELQGLGWEGQEAEKILCKGLPHCMVIVRACPKE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GFAP Antibody
MBS8586354-01 0.1 mg

GFAP Antibody

Sign In for Pricing
View Details
GFAP Antibody
MBS8586354-02 0.1 mL (AF405L)

GFAP Antibody

Sign In for Pricing
View Details
GFAP Antibody
MBS8586354-03 0.1 mL (AF405S)

GFAP Antibody

Sign In for Pricing
View Details
GFAP Antibody
MBS8586354-04 0.1 mL (AF610)

GFAP Antibody

Sign In for Pricing
View Details
GFAP Antibody
MBS8586354-05 0.1 mL (AF635)

GFAP Antibody

Sign In for Pricing
View Details
GFAP Antibody
MBS8586354-06 0.1 mL (APC)

GFAP Antibody

Sign In for Pricing
View Details