Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FBXL20 Peptide - middle region

FBXL20 Peptide - middle region

Product Specifications

Product Name Alternative

FLJ21037, Fbl2, Fbl20, MGC15482, SCR, SCRAPPER

UniProt

Q96IG2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FBXL20 Rabbit Polyclonal Antibody (orb584768) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_116264

Preservative

Lyophilized powder

AA Sequence

ISWCDQVTKDGIQALVRGCGGLKALFLKGCTQLEDEALKYIGAHCPELVT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATP1A1 Rabbit pAb
E2507878 100 µL

ATP1A1 Rabbit pAb

Sign In for Pricing
View Details
ADGRG4 Antibody
E40PV1596 50 µL

ADGRG4 Antibody

Sign In for Pricing
View Details
1- (5-Nitropyridin-2-yl) piperidin-4-amine
sc-297596 500 mg

1- (5-Nitropyridin-2-yl) piperidin-4-amine

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Annexin A4 (ANXA4)
MBS2075399-01 0.1 mL

PE-Linked Polyclonal Antibody to Annexin A4 (ANXA4)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Annexin A4 (ANXA4)
MBS2075399-02 0.2 mL

PE-Linked Polyclonal Antibody to Annexin A4 (ANXA4)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Annexin A4 (ANXA4)
MBS2075399-03 0.5 mL

PE-Linked Polyclonal Antibody to Annexin A4 (ANXA4)

Sign In for Pricing
View Details