Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fbxl3 Peptide - C-terminal region

Fbxl3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

AU041772, AW212966, FBK, Fbl3a, Fbxl3a, Ovtm

UniProt

Q8C4V4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Fbxl3 Rabbit Polyclonal Antibody (orb330282) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_056637

Preservative

Lyophilized powder

AA Sequence

ELLLALSSEKHVRLEHLRIDVVSENPGQTHFHTIQKSSWDAFIKHSPKVN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MROH8 Antibody, Biotin conjugated
A76973-50UL 50 μL

MROH8 Antibody, Biotin conjugated

Sign In for Pricing
View Details
UAP56/DDX39B Rabbit pAb
A8356-01 1000 μL

UAP56/DDX39B Rabbit pAb

Sign In for Pricing
View Details
UAP56/DDX39B Rabbit pAb
A8356-02 20 µL

UAP56/DDX39B Rabbit pAb

Sign In for Pricing
View Details
UAP56/DDX39B Rabbit pAb
A8356-03 100 μL

UAP56/DDX39B Rabbit pAb

Sign In for Pricing
View Details
UAP56/DDX39B Rabbit pAb
A8356-04 500 μL

UAP56/DDX39B Rabbit pAb

Sign In for Pricing
View Details
PLEKHA9 Rabbit Polyclonal Antibody (HRP)
orb475789 100 µL

PLEKHA9 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details