Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fbxl3 Peptide - C-terminal region

Fbxl3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

AU041772, AW212966, FBK, Fbl3a, Fbxl3a, Ovtm

UniProt

Q8C4V4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Fbxl3 Rabbit Polyclonal Antibody (orb330282) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_056637

Preservative

Lyophilized powder

AA Sequence

ELLLALSSEKHVRLEHLRIDVVSENPGQTHFHTIQKSSWDAFIKHSPKVN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-DNAJC6 Antibody Picoband® (Dylight488 Conjugate)
A05616-2-Dylight488 100 µg

Anti-DNAJC6 Antibody Picoband® (Dylight488 Conjugate)

Sign In for Pricing
View Details
Obfc1 sgRNA CRISPR Lentivector (Rat) (Target 2)
K6585103 1.0 µg DNA

Obfc1 sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
Human IgG4 (Ig Heavy Constant Gamma 4) (G4m Marker) (IGHG4/2042R), CF488A conjugate, 0.1mg/mL
BNC882042-100 1x 100 µL

Human IgG4 (Ig Heavy Constant Gamma 4) (G4m Marker) (IGHG4/2042R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Anti-NRL Antibody
CPA1829-01 30 µL

Anti-NRL Antibody

Sign In for Pricing
View Details
Anti-NRL Antibody
CPA1829-02 50 μL

Anti-NRL Antibody

Sign In for Pricing
View Details
Anti-NRL Antibody
CPA1829-03 100 µL

Anti-NRL Antibody

Sign In for Pricing
View Details