Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FBXL4 Peptide - N-terminal region

FBXL4 Peptide - N-terminal region

Product Specifications

Product Name Alternative

FBL4, FBL5

UniProt

Q9UKA2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FBXL4 Rabbit Polyclonal Antibody (orb582519) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_036292

Preservative

Lyophilized powder

AA Sequence

VLETYHPGAVIRILACSANPYSPNPPAEVRWEILWSERPTKVNASQARQF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PathScan® Phospho-IRS-1 (panTyr) Sandwich ELISA Kit
CST 7133V3 20 Kit

PathScan® Phospho-IRS-1 (panTyr) Sandwich ELISA Kit

Sign In for Pricing
View Details
Donkey Matrix Metalloproteinase 26 ELISA Kit
MBS050056 Inquire

Donkey Matrix Metalloproteinase 26 ELISA Kit

Sign In for Pricing
View Details
Goat Gap Junction protein, Alpha 5,40kd ELISA kit
GTR10413104 96 Well

Goat Gap Junction protein, Alpha 5,40kd ELISA kit

Sign In for Pricing
View Details
Vom2r77 (NM_001099519) Rat Tagged ORF Clone Lentiviral Particle
RR200924L3V 200 µL

Vom2r77 (NM_001099519) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
MMP9 Rabbit mAb
E2R24999 100 µL

MMP9 Rabbit mAb

Sign In for Pricing
View Details
Mouse Mup8 protein
orb246112-01 20 µg

Mouse Mup8 protein

Sign In for Pricing
View Details