Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FBXL4 Peptide - N-terminal region

FBXL4 Peptide - N-terminal region

Product Specifications

Product Name Alternative

FBL4, FBL5

UniProt

Q9UKA2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FBXL4 Rabbit Polyclonal Antibody (orb582519) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_036292

Preservative

Lyophilized powder

AA Sequence

VLETYHPGAVIRILACSANPYSPNPPAEVRWEILWSERPTKVNASQARQF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cystatin-C monoclonal antibody
MBS5310786-01 1 mg

Cystatin-C monoclonal antibody

Sign In for Pricing
View Details
Cystatin-C monoclonal antibody
MBS5310786-02 5x 1 mg

Cystatin-C monoclonal antibody

Sign In for Pricing
View Details
Smgc Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV648406 1.0 µg DNA

Smgc Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
Pseudoginsenoside RP1
orb2695036-01 1 mg

Pseudoginsenoside RP1

Sign In for Pricing
View Details
Pseudoginsenoside RP1
orb2695036-02 5 mg

Pseudoginsenoside RP1

Sign In for Pricing
View Details
Pseudoginsenoside RP1
orb2695036-03 10 mg

Pseudoginsenoside RP1

Sign In for Pricing
View Details