Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FBXL5 Peptide - middle region

FBXL5 Peptide - middle region

Product Specifications

Product Name Alternative

FBL4, FBL5, FLR1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FBXL5 Rabbit Polyclonal Antibody (orb578718) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_277077

Preservative

Lyophilized powder

AA Sequence

LRTMSSLPESSAMCRKAARTRLPRGKDLIYFGSEKSDQETGRVLLFLSLS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NCF4 Antibody
orb1314930 100 µL

NCF4 Antibody

Sign In for Pricing
View Details
Box of 50 Sterile Pp Syringe Filter 0.45µm, 25 Mm
SF25PP45SL Box of 50

Box of 50 Sterile Pp Syringe Filter 0.45µm, 25 Mm

Sign In for Pricing
View Details
PP4R4 (PPP4R4) Mouse Monoclonal Antibody [Clone ID: LBI1G7]
AMM19736V 100 µL

PP4R4 (PPP4R4) Mouse Monoclonal Antibody [Clone ID: LBI1G7]

Sign In for Pricing
View Details
Bis-Tris Buffer 0.5M, pH 6.0
40220011-2 250 mL

Bis-Tris Buffer 0.5M, pH 6.0

Sign In for Pricing
View Details
MRPL28 Recombinant Antibody, Cy5.5 Conjugated
bsm-62446R-Cy5.5 100 µL

MRPL28 Recombinant Antibody, Cy5.5 Conjugated

Sign In for Pricing
View Details
SRC Antibody
MBS9602585-01 0.05 mL

SRC Antibody

Sign In for Pricing
View Details