Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FBXL8 Peptide - N-terminal region

FBXL8 Peptide - N-terminal region

Product Specifications

Product Name Alternative

FBL8, FLJ11278, MGC19959

UniProt

Q96CD0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FBXL8 Rabbit Polyclonal Antibody (orb585429) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060848

Preservative

Lyophilized powder

AA Sequence

KPSRRAAIELLMVLAGRAPGLRGLRLECRGEKPLFDAGRDVLEAVHAVCG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Calponin-1 (CNN1/832), CF640R conjugate, 0.1mg/mL
BNC400832-500 1x 500 µL

Calponin-1 (CNN1/832), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD163 Antibody
KC-2750-01 50 μL

CD163 Antibody

Sign In for Pricing
View Details
CD163 Antibody
KC-2750-02 100 µL

CD163 Antibody

Sign In for Pricing
View Details
CD163 Antibody
KC-2750-03 1 mL

CD163 Antibody

Sign In for Pricing
View Details
CD276 Recombinant Rabbit monoclonal Antibody
HA750811 100 µL

CD276 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
CD117 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2B5]
TA801047AM 100 µL

CD117 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2B5]

Sign In for Pricing
View Details