Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FBXL8 Peptide - N-terminal region

FBXL8 Peptide - N-terminal region

Product Specifications

Product Name Alternative

FBL8, FLJ11278, MGC19959

UniProt

Q96CD0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FBXL8 Rabbit Polyclonal Antibody (orb585429) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060848

Preservative

Lyophilized powder

AA Sequence

KPSRRAAIELLMVLAGRAPGLRGLRLECRGEKPLFDAGRDVLEAVHAVCG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MEK7 (MAP2K7) (incl. pos. control) Mouse Monoclonal Antibody [Clone ID: 10F7]
AM00096PU-N 100 µg

MEK7 (MAP2K7) (incl. pos. control) Mouse Monoclonal Antibody [Clone ID: 10F7]

Sign In for Pricing
View Details
RAD51 (Ab-315) Antibody
8B1117-AAT 50 µg

RAD51 (Ab-315) Antibody

Sign In for Pricing
View Details
ESS2 Human Gene Knockout Kit (CRISPR)
KN400743 1 Kit

ESS2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human C6orf120 activation kit by CRISPRa
GA117879 1 Kit

Human C6orf120 activation kit by CRISPRa

Sign In for Pricing
View Details
6-(5-Chloro-2-pyridyl)-6,7-dihydro-7-hydroxy-5H-pyrrolo[3,4-b]pyrazin-5-one
TRC-C379925-50MG 50 mg

6-(5-Chloro-2-pyridyl)-6,7-dihydro-7-hydroxy-5H-pyrrolo[3,4-b]pyrazin-5-one

Sign In for Pricing
View Details
MEF2C Rabbit Polyclonal Antibody
TA378449 100 µL

MEF2C Rabbit Polyclonal Antibody

Sign In for Pricing
View Details