Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fbxo11 Peptide - C-terminal region

Fbxo11 Peptide - C-terminal region

Product Specifications

Product Name Alternative

C80048, Jf, MGC156416

UniProt

E9QP06

Field of Research

Cancer Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Fbxo11 Rabbit Polyclonal Antibody (orb578789) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001074503

Preservative

Lyophilized powder

AA Sequence

RRNKIHDGRDGGICIFNGGRGLLEENDIFRNAQAGVLISTNSHPVLRKNR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (EGP40/2571R), CF488A conjugate, 0.1mg/mL
BNC882571-500 1x 500 µL

Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (EGP40/2571R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
BSX (NM_001098169) Human Over-expression Lysate
LC420545 20 µg

BSX (NM_001098169) Human Over-expression Lysate

Sign In for Pricing
View Details
Rab6 (BC019118) Mouse Tagged ORF Clone
MG202223 10 µg

Rab6 (BC019118) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Slc25a37 (BC040399) Mouse Tagged ORF Clone
MG201755 10 µg

Slc25a37 (BC040399) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Tissue Total RNA, Stomach
CR561367 5 µg

Tissue Total RNA, Stomach

Sign In for Pricing
View Details
MGMT Mouse Monoclonal Antibody [Clone ID: OTI17H4]
CF809255 100 µg

MGMT Mouse Monoclonal Antibody [Clone ID: OTI17H4]

Sign In for Pricing
View Details