Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fbxo11 Peptide - C-terminal region

Fbxo11 Peptide - C-terminal region

Product Specifications

Product Name Alternative

C80048, Jf, MGC156416

UniProt

E9QP06

Field of Research

Cancer Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Fbxo11 Rabbit Polyclonal Antibody (orb578789) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001074503

Preservative

Lyophilized powder

AA Sequence

RRNKIHDGRDGGICIFNGGRGLLEENDIFRNAQAGVLISTNSHPVLRKNR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZG16B Human Gene Knockout Kit (CRISPR)
KN202244BN 1 Kit

ZG16B Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
IGFL2 (NM_001135113) Human Over-expression Lysate
LY427558 100 µg

IGFL2 (NM_001135113) Human Over-expression Lysate

Sign In for Pricing
View Details
Hydroxy Chlorodenafil
TRC-H825115-250MG 250 mg

Hydroxy Chlorodenafil

Sign In for Pricing
View Details
Recombinant Human IL-8 protein (GST tag)
PDEH100775-01 20 µg

Recombinant Human IL-8 protein (GST tag)

Sign In for Pricing
View Details
Recombinant Human IL-8 protein (GST tag)
PDEH100775-02 100 µg

Recombinant Human IL-8 protein (GST tag)

Sign In for Pricing
View Details
Recombinant Human IL-8 protein (GST tag)
PDEH100775-03 500 µg

Recombinant Human IL-8 protein (GST tag)

Sign In for Pricing
View Details