Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fbxo2 Peptide - C-terminal region

Fbxo2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FBG1, FBX2, Fbs1, Fbs2, MGC54895, NFB42, Prpl4

UniProt

Q80UW2

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Fbxo2 Rabbit Polyclonal Antibody (orb578720) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_789818

Preservative

Lyophilized powder

AA Sequence

LAEFATGQVAVPEDGSWMEISHTFIDYGPGVRFVRFEHGGQDSVYWKGWF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ULK4P3 Protein Vector (Human) (pPB-C-His)
PV141974 500 ng

ULK4P3 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Olr1619 3'UTR Lenti-reporter-Luc Vector
34086086 1.0 µg

Olr1619 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Mouse Monoclonal GPR64 Antibody (864238) [Allophycocyanin]
FAB79771A 0.1 mL

Mouse Monoclonal GPR64 Antibody (864238) [Allophycocyanin]

Sign In for Pricing
View Details
Thioredoxin 2 (TXN2) Rabbit Polyclonal Antibody
TA334463 100 µL

Thioredoxin 2 (TXN2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TRAV16 sgRNA CRISPR Lentivector (Human) (Target 1)
K2444902 1.0 µg DNA

TRAV16 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
FAM170B Peptide - C-terminal region (AAP70353)
AAP70353-100UG 100 µg

FAM170B Peptide - C-terminal region (AAP70353)

Sign In for Pricing
View Details