Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fbxo2 Peptide - C-terminal region

Fbxo2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FBG1, FBX2, Fbs1, Fbs2, MGC54895, NFB42, Prpl4

UniProt

Q80UW2

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Fbxo2 Rabbit Polyclonal Antibody (orb578720) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_789818

Preservative

Lyophilized powder

AA Sequence

LAEFATGQVAVPEDGSWMEISHTFIDYGPGVRFVRFEHGGQDSVYWKGWF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PANK4 Rabbit Polyclonal Antibody
TA344906 100 µL

PANK4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
HCG-alpha Antibody
V5175SAF-100UG 100 µg

HCG-alpha Antibody

Sign In for Pricing
View Details
TAG-72 / CA72.4 (Tumor-Associated Glycoprotein) (rB72.3), CF740 conjugate, 0.1mg/mL
BNC743177-100 1x 100 µL

TAG-72 / CA72.4 (Tumor-Associated Glycoprotein) (rB72.3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
2- (2,4-dichloro-3-methylphenyl) -2-methyl-1,3-dioxolane
OR1090651-01 250 mg

2- (2,4-dichloro-3-methylphenyl) -2-methyl-1,3-dioxolane

Sign In for Pricing
View Details
2- (2,4-dichloro-3-methylphenyl) -2-methyl-1,3-dioxolane
OR1090651-02 500 mg

2- (2,4-dichloro-3-methylphenyl) -2-methyl-1,3-dioxolane

Sign In for Pricing
View Details
2- (2,4-dichloro-3-methylphenyl) -2-methyl-1,3-dioxolane
OR1090651-03 1 g

2- (2,4-dichloro-3-methylphenyl) -2-methyl-1,3-dioxolane

Sign In for Pricing
View Details