Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fbxo22 Peptide - middle region

Fbxo22 Peptide - middle region

Product Specifications

Product Name Alternative

0610033L19Rik, 1600016C16Rik

UniProt

Q3V492

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Fbxo22 Rabbit Polyclonal Antibody (orb582521) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_082325

Preservative

Lyophilized powder

AA Sequence

HFIKDSKNLTLERHQLTEVGLLDNPELRVVLVFGYNCCKVGASNYLHRVV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human NSRP1 activation kit by CRISPRa
GA113365 1 Kit

Human NSRP1 activation kit by CRISPRa

Sign In for Pricing
View Details
Sarcosine Ethyl Ester Hydrochloride
TRC-S140510-10G 10 g

Sarcosine Ethyl Ester Hydrochloride

Sign In for Pricing
View Details
Recombinant ERBB2 (phospho Y1139) Antibody
RC-16637-01 50 μL

Recombinant ERBB2 (phospho Y1139) Antibody

Sign In for Pricing
View Details
Recombinant ERBB2 (phospho Y1139) Antibody
RC-16637-02 100 µL

Recombinant ERBB2 (phospho Y1139) Antibody

Sign In for Pricing
View Details
Recombinant ERBB2 (phospho Y1139) Antibody
RC-16637-03 1 mL

Recombinant ERBB2 (phospho Y1139) Antibody

Sign In for Pricing
View Details
p-Tolyl Sulfate-d7 Potassium Salt
TRC-T536802-25MG 25 mg

p-Tolyl Sulfate-d7 Potassium Salt

Sign In for Pricing
View Details