Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fbxo22 Peptide - middle region

Fbxo22 Peptide - middle region

Product Specifications

Product Name Alternative

0610033L19Rik, 1600016C16Rik

UniProt

Q3V492

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Fbxo22 Rabbit Polyclonal Antibody (orb582521) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_082325

Preservative

Lyophilized powder

AA Sequence

HFIKDSKNLTLERHQLTEVGLLDNPELRVVLVFGYNCCKVGASNYLHRVV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant PCNA Monoclonal Antibody
AN300996L-01 50 µL

Recombinant PCNA Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant PCNA Monoclonal Antibody
AN300996L-02 100 µL

Recombinant PCNA Monoclonal Antibody

Sign In for Pricing
View Details
SCAMP5 (NM_001178112) Human Over-expression Lysate
LY432736 100 µg

SCAMP5 (NM_001178112) Human Over-expression Lysate

Sign In for Pricing
View Details
Platinum On Carbon (10 wt. %)
TRC-P578005-2.5G 2.5 g

Platinum On Carbon (10 wt. %)

Sign In for Pricing
View Details
Fascin (FSCN1) Mouse Monoclonal Antibody [Clone ID: OTI3D2]
CF807295 100 µg

Fascin (FSCN1) Mouse Monoclonal Antibody [Clone ID: OTI3D2]

Sign In for Pricing
View Details
CCL7 Polyclonal Antibody
E-AB-40149-01 25 µL

CCL7 Polyclonal Antibody

Sign In for Pricing
View Details