Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FBXO32 Peptide - N-terminal region

FBXO32 Peptide - N-terminal region

Product Specifications

Product Name Alternative

FLJ32424, Fbx32, MAFbx, MGC33610

UniProt

Q0VAQ6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FBXO32 Rabbit Polyclonal Antibody (orb330700) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_680482

Preservative

Lyophilized powder

AA Sequence

QQQLNNIQITRPAFKGLTFTDLPLCLQLNIMQRLSDGRDLVSLGQAAPDL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CF®405L Protein Labeling Kit , 3x (1mg) labelings
#92228 1 Kit

CF®405L Protein Labeling Kit , 3x (1mg) labelings

Sign In for Pricing
View Details
Recombinant Human IL18BP Protein (Fc Tag)
PKSH032626-01 10 µg

Recombinant Human IL18BP Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Human IL18BP Protein (Fc Tag)
PKSH032626-02 50 µg

Recombinant Human IL18BP Protein (Fc Tag)

Sign In for Pricing
View Details
Bmi1 (COMMD3-BMI1) Goat Polyclonal Antibody
AP07560PU-N 50 µg

Bmi1 (COMMD3-BMI1) Goat Polyclonal Antibody

Sign In for Pricing
View Details
XFD532 NHS Ester
1819-AAT 1 mg

XFD532 NHS Ester

Sign In for Pricing
View Details
Triethylammonium Sulfate
TRC-T797470-500MG 500 mg

Triethylammonium Sulfate

Sign In for Pricing
View Details