Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FBXO32 Peptide - N-terminal region

FBXO32 Peptide - N-terminal region

Product Specifications

Product Name Alternative

FLJ32424, Fbx32, MAFbx, MGC33610

UniProt

Q0VAQ6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FBXO32 Rabbit Polyclonal Antibody (orb330700) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_680482

Preservative

Lyophilized powder

AA Sequence

QQQLNNIQITRPAFKGLTFTDLPLCLQLNIMQRLSDGRDLVSLGQAAPDL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Etafedrine Hydrochloride (mixture of diastereomers)
TRC-E889200-25MG 25 mg

Etafedrine Hydrochloride (mixture of diastereomers)

Sign In for Pricing
View Details
(R,R)-Isophytol
TRC-I821985-25MG 25 mg

(R,R)-Isophytol

Sign In for Pricing
View Details
LRP6 Human Gene Knockout Kit (CRISPR)
KN418918 1 Kit

LRP6 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
IKB alpha (NFKBIA) pSer32/36 Rabbit Polyclonal Antibody
AP02436PU-S 50 µL

IKB alpha (NFKBIA) pSer32/36 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
NPTXR Antibody
KC-2786-01 50 μL

NPTXR Antibody

Sign In for Pricing
View Details
NPTXR Antibody
KC-2786-02 100 µL

NPTXR Antibody

Sign In for Pricing
View Details