Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FBXO34 Peptide - middle region

FBXO34 Peptide - middle region

Product Specifications

Product Name Alternative

CGI-301, DKFZp547C162, FLJ20725, Fbx34, MGC126434, MGC126435

UniProt

Q9NWN3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FBXO34 Rabbit Polyclonal Antibody (orb583433) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060413

Preservative

Lyophilized powder

AA Sequence

ESECLKRQGQREPGSLSRNNSFRRNVGRVLLANSTQADEGKTKKGVLEAP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LentimiRa-mmu-miR-6930-5p Vector
mm41585 500 ng

LentimiRa-mmu-miR-6930-5p Vector

Sign In for Pricing
View Details
Human ZNHIT6 qPCR Primer Pair
QH08697S 200 Tests

Human ZNHIT6 qPCR Primer Pair

Sign In for Pricing
View Details
SGLT-2 (D-6) HRP
sc-393350 HRP 200 µg/mL

SGLT-2 (D-6) HRP

Sign In for Pricing
View Details
TARBP2 Antibody
A55763-50UL 50 μL

TARBP2 Antibody

Sign In for Pricing
View Details
TNP2 siRNA (Rat)
orb1833586-01 15 nmol

TNP2 siRNA (Rat)

Sign In for Pricing
View Details
TNP2 siRNA (Rat)
orb1833586-02 30 nmol

TNP2 siRNA (Rat)

Sign In for Pricing
View Details