Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FBXO34 Peptide - middle region

FBXO34 Peptide - middle region

Product Specifications

Product Name Alternative

CGI-301, DKFZp547C162, FLJ20725, Fbx34, MGC126434, MGC126435

UniProt

Q9NWN3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FBXO34 Rabbit Polyclonal Antibody (orb583433) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060413

Preservative

Lyophilized powder

AA Sequence

ESECLKRQGQREPGSLSRNNSFRRNVGRVLLANSTQADEGKTKKGVLEAP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAGEB3 Peptide - N-terminal region
MBS3237660-01 0.1 mg

MAGEB3 Peptide - N-terminal region

Sign In for Pricing
View Details
MAGEB3 Peptide - N-terminal region
MBS3237660-02 5x 0.1 mg

MAGEB3 Peptide - N-terminal region

Sign In for Pricing
View Details
Chicken Pancreas Total Protein
CT-313 1 mg

Chicken Pancreas Total Protein

Sign In for Pricing
View Details
DLC-1 CRISPR/Cas9 KO Plasmid (m)
sc-424482 20 µg

DLC-1 CRISPR/Cas9 KO Plasmid (m)

Sign In for Pricing
View Details
Fibulin-2 Polyclonal Antibody
RA24962-01 50 µL

Fibulin-2 Polyclonal Antibody

Sign In for Pricing
View Details
Fibulin-2 Polyclonal Antibody
RA24962-02 100 µL

Fibulin-2 Polyclonal Antibody

Sign In for Pricing
View Details