Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fbxw4 Peptide - C-terminal region

Fbxw4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Fbxw4

UniProt

D4A2V7

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Fbxw4 Rabbit Polyclonal Antibody (orb583622) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001101070

Preservative

Lyophilized powder

AA Sequence

STFYCLQTDGNHLLATGSSYYGLVRLWDRRQRACLHAFPLTSTPLSSPVY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Nab2 Antibody (OTI5D7) [Allophycocyanin]
NBP2-72868APC 0.1 mL

Mouse Monoclonal Nab2 Antibody (OTI5D7) [Allophycocyanin]

Sign In for Pricing
View Details
Guinea Pig Mitochondrial import receptor subunit TOM40B (TOMM40L) ELISA Kit
GTR10366567 96 Well

Guinea Pig Mitochondrial import receptor subunit TOM40B (TOMM40L) ELISA Kit

Sign In for Pricing
View Details
P2Y6 (P2RY6) (NM_176797) Human Over-expression Lysate
LC406125 20 µg

P2Y6 (P2RY6) (NM_176797) Human Over-expression Lysate

Sign In for Pricing
View Details
NKAP sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
31863111 3x 1.0 µg

NKAP sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
RPL5 (60S Ribosomal Protein L5) (HRP)
303978-01 50 µg

RPL5 (60S Ribosomal Protein L5) (HRP)

Sign In for Pricing
View Details
RPL5 (60S Ribosomal Protein L5) (HRP)
303978-02 100 µg

RPL5 (60S Ribosomal Protein L5) (HRP)

Sign In for Pricing
View Details