Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fbxw4 Peptide - C-terminal region

Fbxw4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Fbxw4

UniProt

D4A2V7

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Fbxw4 Rabbit Polyclonal Antibody (orb583622) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001101070

Preservative

Lyophilized powder

AA Sequence

STFYCLQTDGNHLLATGSSYYGLVRLWDRRQRACLHAFPLTSTPLSSPVY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Aquaporin 2 (Ser261) Antibody
p112-261 100 µL

Anti-Aquaporin 2 (Ser261) Antibody

Sign In for Pricing
View Details
Anti-PerCP IgG 2a isotype control (Mouse, Monoclonal)
A105346 100 µL

Anti-PerCP IgG 2a isotype control (Mouse, Monoclonal)

Sign In for Pricing
View Details
Rabbit Polyclonal ANAPC16 Antibody
NBP1-89048-25ul 25 µL

Rabbit Polyclonal ANAPC16 Antibody

Sign In for Pricing
View Details
Gm4187 AAV siRNA Pooled Vector
22015164 1.0 µg

Gm4187 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
NAGLU Human shRNA Lentiviral Particle (Locus ID 4669)
TL311273V 500 µL Each

NAGLU Human shRNA Lentiviral Particle (Locus ID 4669)

Sign In for Pricing
View Details
Gm1661 (NM_001145637) Mouse Tagged ORF Clone Lentiviral Particle
MR214287L3V 200 µL

Gm1661 (NM_001145637) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details