Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fbxw7 Peptide - middle region

Fbxw7 Peptide - middle region

Product Specifications

Product Name Alternative

1110001A17Rik, AGO, Cdc4, Fbw7, Fbwd6, Fbx30, Fbxo30, Fbxw6, SEL-10

UniProt

Q8VBV4

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Fbxw7 Rabbit Polyclonal Antibody (orb576309) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

IHC, WB

NCBI Accession Number

NP_536353

Preservative

Lyophilized powder

AA Sequence

GIDEPLHIKRRKIIKPGFIHSPWKSAYIRQHRIDTNWRRGELKSPKVLKG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARL13B Rabbit pAb
E47R21493 100 µL

ARL13B Rabbit pAb

Sign In for Pricing
View Details
Recombinant Alpha-Fodrin (SPTAN1)
MBS2010048-01 0.01 mg

Recombinant Alpha-Fodrin (SPTAN1)

Sign In for Pricing
View Details
Recombinant Alpha-Fodrin (SPTAN1)
MBS2010048-02 0.05 mg

Recombinant Alpha-Fodrin (SPTAN1)

Sign In for Pricing
View Details
Recombinant Alpha-Fodrin (SPTAN1)
MBS2010048-03 0.1 mg

Recombinant Alpha-Fodrin (SPTAN1)

Sign In for Pricing
View Details
Recombinant Alpha-Fodrin (SPTAN1)
MBS2010048-04 0.2 mg

Recombinant Alpha-Fodrin (SPTAN1)

Sign In for Pricing
View Details
Recombinant Alpha-Fodrin (SPTAN1)
MBS2010048-05 0.5 mg

Recombinant Alpha-Fodrin (SPTAN1)

Sign In for Pricing
View Details