FCER1G Peptide - N-terminal region
FCER1G Peptide - N-terminal region
Product Specifications
Product Name Alternative
FCRG
UniProt
P30273
Field of Research
Immunology & Inflammation
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with FCER1G Rabbit Polyclonal Antibody (orb579777) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_004097
Preservative
Lyophilized powder
AA Sequence
MIPAVVLLLLLLVEQAAALGEPQLCYILDAILFLYGIVLTLLYCRLKIQV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC740050-100 1x 100 µL
IgA Secretory Component (SC05), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940034-100 1x 100 µL
Cytokeratin 8/18 (C-51), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040026-100 1x 100 µL
ACTH (Adrenocorticotrophic Hormone) (AH26), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740689-500 1x 500 µL
Cytokeratin 8 (K8.8), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880914-100 1x 100 µL
NGFR (Nerve Growth Factor Receptor) (NGFR5 + NTR/912), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details