FCRLB Peptide - N-terminal region
FCRLB Peptide - N-terminal region
Product Specifications
Product Name Alternative
FCRL2, FCRLM2, FCRLY, FLJ31052, FREB-2, FcRY, RP11-474I16.6
UniProt
Q6BAA4
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with FCRLB Rabbit Polyclonal Antibody (orb585369) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001002901
Preservative
Lyophilized powder
AA Sequence
DKVVYKLHYYHDGQAVRYFHSSANYTVLQARASDSGRYQCSGTMRIPVES
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC881081-100 1x 100 µL
CD45RO (190-2F2.5), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400034-100 1x 100 µL
Cytokeratin 8/18 (C-51), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940040-100 1x 100 µL
CD35 / CR1 (E11), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680495-100 1x 100 µL
SUMO-1 (SM1/495), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC401783-100 1x 100 µL
CD45RB (B-Cell Marker) (PTPRC/1783R), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details