Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FEN1 Peptide - N-terminal region

FEN1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

FEN-1, MF1, RAD2

UniProt

P39748

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FEN1 Rabbit Polyclonal Antibody (orb579666) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004102

Preservative

Lyophilized powder

AA Sequence

APSAIRENDIKSYFGRKVAIDASMSIYQFLIAVRQGGDVLQNEEGETTSH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

STAT1 Mouse Monoclonal Antibody [Clone ID: 1141CT26.2.1]
TA324835 400 µL

STAT1 Mouse Monoclonal Antibody [Clone ID: 1141CT26.2.1]

Sign In for Pricing
View Details
Syntaxin 6 (h) : 293 Lysate
sc-173786 100 µg - 200 µL

Syntaxin 6 (h) : 293 Lysate

Sign In for Pricing
View Details
ATF2, phosphorylated (Thr71 or 53)
398243-01 50 µL

ATF2, phosphorylated (Thr71 or 53)

Sign In for Pricing
View Details
ATF2, phosphorylated (Thr71 or 53)
398243-02 100 µL

ATF2, phosphorylated (Thr71 or 53)

Sign In for Pricing
View Details
Anti-Eukaryotic Elongation Factor 2 Kinase (EEF2K)
FY-AB53188-01 1 mL

Anti-Eukaryotic Elongation Factor 2 Kinase (EEF2K)

Sign In for Pricing
View Details
Anti-Eukaryotic Elongation Factor 2 Kinase (EEF2K)
FY-AB53188-02 100 µL

Anti-Eukaryotic Elongation Factor 2 Kinase (EEF2K)

Sign In for Pricing
View Details