Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FEN1 Peptide - N-terminal region

FEN1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

FEN-1, MF1, RAD2

UniProt

P39748

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FEN1 Rabbit Polyclonal Antibody (orb579666) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004102

Preservative

Lyophilized powder

AA Sequence

APSAIRENDIKSYFGRKVAIDASMSIYQFLIAVRQGGDVLQNEEGETTSH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Senataxin Antibody (4G1) [DyLight 488]
NBP2-52726G 0.1 mL

Mouse Monoclonal Senataxin Antibody (4G1) [DyLight 488]

Sign In for Pricing
View Details
Recombinant SARS-CoV-2 (2019-nCoV) S Protein RBD (L452R), His Tag
E28AB0014 50 µg

Recombinant SARS-CoV-2 (2019-nCoV) S Protein RBD (L452R), His Tag

Sign In for Pricing
View Details
RASSF4 Antibody
MBS7116944-01 0.05 mg

RASSF4 Antibody

Sign In for Pricing
View Details
RASSF4 Antibody
MBS7116944-02 0.1 mg

RASSF4 Antibody

Sign In for Pricing
View Details
RASSF4 Antibody
MBS7116944-03 5x 0.1 mg

RASSF4 Antibody

Sign In for Pricing
View Details
Rabbit Anti-SPG20/Spartin antibody
SL17657R-01 50 µL

Rabbit Anti-SPG20/Spartin antibody

Sign In for Pricing
View Details