FGD3 Peptide - middle region
FGD3 Peptide - middle region
Product Specifications
Product Name Alternative
FLJ00004, MGC117260, ZFYVE5
UniProt
Q5JSP0
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with FGD3 Rabbit Polyclonal Antibody (orb585322) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_149077
Preservative
Lyophilized powder
AA Sequence
STSPVEPVVTTEGSSGAAGLEPRKLSSKTRRDKEKQSCKSCGETFNSITK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC940009-100 1x 100 µL
MART-1 / Melan-A (M2-7C10), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040679-500 1x 500 µL
CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC941836-100 1x 100 µL
NKX2.2 (Neuroendocrine & Ewing s Sarcoma Marker) (rNX2/294), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details