Fgf1 Peptide - N-terminal region
Fgf1 Peptide - N-terminal region
Product Specifications
Product Name Alternative
HBGF1, HBGF-1, Fgf1
UniProt
P61149
Field of Research
Cardiovascular Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Fgf1 Rabbit Polyclonal Antibody (orb574865) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_036978
Preservative
Lyophilized powder
AA Sequence
MAEGEITTFAALTERFNLPLGNYKKPKLLYCSNGGHFLRILPDGTVDGTR
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
YXC55364-01 50 mg
7-Bromo-2, 3-dihydro-4H-1, 3-benzothiazin-4-one 1, 1-dioxide
Sign In for Pricing
View Details YXC55364-02 0.5 g
7-Bromo-2, 3-dihydro-4H-1, 3-benzothiazin-4-one 1, 1-dioxide
Sign In for Pricing
View Details LV750440 1.0 µg DNA
TIMM8BP1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
Sign In for Pricing
View Details MBS6312945-01 0.1 mL
KCTD8, CT (KCTD8, BTB/POZ domain-containing protein KCTD8) (MaxLight 405)
Sign In for Pricing
View Details MBS6312945-02 5x 0.1 mL
KCTD8, CT (KCTD8, BTB/POZ domain-containing protein KCTD8) (MaxLight 405)
Sign In for Pricing
View Details 