Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fgf1 Peptide - N-terminal region

Fgf1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

Dffrx, Fam, Fgf-1, Fgfa

UniProt

P61148

Field of Research

Cardiovascular Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Fgf1 Rabbit Polyclonal Antibody (orb575042) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_034327

Preservative

Lyophilized powder

AA Sequence

ALTERFNLPLGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VEGFA (NM_001025370) Human Over-expression Lysate
LC422439 20 µg

VEGFA (NM_001025370) Human Over-expression Lysate

Sign In for Pricing
View Details
Human GOLPH2 (GOLM1) activation kit by CRISPRa
GA109700 1 Kit

Human GOLPH2 (GOLM1) activation kit by CRISPRa

Sign In for Pricing
View Details
Fgf1 (NM_010197) Mouse Tagged ORF Clone
MG201152 10 µg

Fgf1 (NM_010197) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Tissue Genomic DNA, Uterus
CD564167 5 µg

Tissue Genomic DNA, Uterus

Sign In for Pricing
View Details
SERPINB3 Human Gene Knockout Kit (CRISPR)
KN402683 1 Kit

SERPINB3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Matrin-3 Antibody
KC-28899-01 50 μL

Matrin-3 Antibody

Sign In for Pricing
View Details