Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fgf1 Peptide - N-terminal region

Fgf1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

Dffrx, Fam, Fgf-1, Fgfa

UniProt

P61148

Field of Research

Cardiovascular Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Fgf1 Rabbit Polyclonal Antibody (orb575042) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_034327

Preservative

Lyophilized powder

AA Sequence

ALTERFNLPLGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD45RB (B-Cell Marker) (PTPRC/2877R), CF740 conjugate, 0.1mg/mL
BNC742877-500 1x 500 µL

CD45RB (B-Cell Marker) (PTPRC/2877R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TRNT1 Human Gene Knockout Kit (CRISPR)
KN403043 1 Kit

TRNT1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
INF2 Polyclonal Antibody
E-AB-90045-01 60 µL

INF2 Polyclonal Antibody

Sign In for Pricing
View Details
INF2 Polyclonal Antibody
E-AB-90045-02 120 µL

INF2 Polyclonal Antibody

Sign In for Pricing
View Details
INF2 Polyclonal Antibody
E-AB-90045-03 200 µL

INF2 Polyclonal Antibody

Sign In for Pricing
View Details
ETV4 Antibody
8C10614-AAT 50 µg

ETV4 Antibody

Sign In for Pricing
View Details